E. coli GrpE

Recombinant Escherichia coli grpE DAG1714 E. coli Lot. No. (See product label) PRODUCT INFORMATION Product overview Escherichia coli grpE (NP_417104) recombinant protein expressed inEscherichia coli. Source E. coli Species E. coli Tag N/A Form Liquid Molecular Mass 23.4kDa AA Sequence MSSKEQKTPEGQAPEEIIMDQHEEIEAVEPEASAEQVDPRDEKIANLEAQLAEAQTRERDGILRVKAE MENLRRRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDVVRKF GVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTVAKAKA Purity Conventional Chromatography Applications SDSPAGE PACKAGING Storage Store at 20°C. For long term storage store at 80°C. Aliquot to avoid repeated freezing and thawing. Concentration 1 mg/mL Buffer In 20 mM Tris, 100mM NaCl, pH 8.0 BACKGROUND Introduction GrpE is a socalled cochaperone because it is known to assist the DnaK (Hsp70) protein to effectively carry out DnaKdependent chaperone activity (i.e. protein folding, protein transport, disaggregation of heat inactivated proteins, activation of mutant protein). GrpE acts as a nucleotide exchange factor for DnaK, the main Hsp70 protein in bacteria, accelerating ADP/ATP exchange by several orders of magnitude. Unfolded proteins bind initially to dnaJ; upon interaction with the dnaJbound protein, dnaK hydrolyzes its bound ATP, resulting in the formation of a stable complex. GrpE releases ADP from dnaK; ATP binding to dnaK triggers the release of the substrate protein, thus completing the reaction cycle. GrpE may also function as a thermosensor. GrpE is a homodimer, each subunit containing three structural domains: a Nterminal unordered segment, two long coils and a Cterminal globular domain formed by a fourhelix bundle, and a betasubdomain. Keywords ECK2610; JW2594; grpE; heat shock protein REFERENCES 1. Prokaryotic Chaperones Support Yeast Prions and Thermotolerance and Define Disaggregation Machinery Interactions. Reidy M, et al. Genetics, 2012 Jun 25. PMID 22732191. 2. Probing the stability and mechanism for folding of the GrpE1112 tetrameric deletion mutant of the GrpE protein from E. coli. Mehl AF, et al. Biochem Biophys Res Commun, 2012 Apr 13. PMID 22450325. IMAGES Creative Diagnostics. All rights reserved 4516 Ramsey Road Shirley, NY 11967, USA Tel: 6316244882 ·Fax:6316147828 Email: info@creativediagnostics.com www.creativediagnostics.com Creative Diagnostics. All rights reserved 4516 Ramsey Road Shirley, NY 11967, USA Tel: 6316244882 ·Fax:6316147828 Email: info@creativediagnostics.com www.creativediagnostics.com