EV71 VP1 [GST]

Recombinant Enterovirus 71 VP1, GSTtagged DAG1665 EV71 Lot. No. (See product label) PRODUCT INFORMATION Product overview EV71 VP1 partial ORF ( AAP82198.1, 1 a.a. 297 a.a.) recombinant protein with GSTtag at N terminal. Antigen Description Human Enterovirus 71 (EV71), the newest member of Enterovirudae, is notable for itsetiological role in epidemics of severe neurological diseases in children. Itappears to be emerging as an important virulent neurotropic enterovirus inthe upcoming era of poliomyelitis eradication. The illness usually peaks inJune or July. EV71 infection may be asymptomatic or may cause diarrhea andrashes. EV71 one of the major causative agents for hand, foot and mouthdisease (HFMD), is sometimes associated with severe central nervous systemdiseases. Direct detection of virus is the mainstay of diagnosis. EV 71 canbe isolated from throat and stool specimens, as well as from skin vesiclefuid. Source wheat germ Species EV71 Tag GST Molecular Mass 59.07kDa AA Sequence GDRVADVIESSIGDSVSRALTQALPAPTGQNTQVSSHRLDTGEVPALQAAEIGASSNTSDESMIETRC VLNSHSTAETTLDSFFSRAGLVGEIDLPLEGTTNPNGYANWDIDITGYAQMRRKVELFTYMRFDAEFT FVACTPTGGVVPQLLQYMFVPPGAPKPDSRESLAWQTATNPSVFVKLTDPPAQVSVPFMSPASAYQ WFYDGYPTFGEHKQEKDLEYGACPNNMMGTFSVRTVGSSKSKYPLVVRIYMRMKHVRAWIPRPMR NQNYLFKANPNYAGNSIKPTGTSRTAITTL Purity Glutathione Sepharose 4 Fast Flow Applications Enzymelinked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array Notes Best use within three months from the date of receipt of this protein. PACKAGING Storage Store at 80°C. Aliquot to avoid repeated freezing and thawing. Buffer 50 mM TrisHCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. BACKGROUND Introduction Enterovirus 71 (EV71) is a virus of the genus Enterovirus in the Picornaviridae family notable for its etiological role in epidemics of severe neurological diseases in children. It was first isolated and characterized from cases of neurological disease in California in 1969. Keywords Enterovirus 71; EV71 REFERENCES 1. Identification of OASL d, a splice variant of human OASL, with antiviral activity. Guo X, Li X, Xu Y, Sun T, Yang G, Wu Z, Li E.Int J Biochem Cell Biol. 2012 Apr 17. Creative Diagnostics. All rights reserved 4516 Ramsey Road Shirley, NY 11967, USA Tel: 6316244882 ·Fax:6316147828 Email: info@creativediagnostics.com www.creativediagnostics.com IMAGES Creative Diagnostics. All rights reserved 4516 Ramsey Road Shirley, NY 11967, USA Tel: 6316244882 ·Fax:6316147828 Email: info@creativediagnostics.com www.creativediagnostics.com