We use cookies to give you the best possible experience on our website.
By using this website, you consent to the use of cookies in accordance with our
cookie policy.

ADP-Glo Kinase Assay + CDK9/CyclinK Kinase Enzyme System (1 each)

Log in to see price
In Stock Free Delivery

V4105

Description

See All Kinase Enzyme Systems
Recombinant full-length human CDK9 and CyclinK proteins were co-expressed by baculovirus in Sf9 insect cells using an N-terminal GST tag. CDK9/CyclinK is a member of the cyclin-dependent protein kinase (CDK) family. CDK9 is closely related to cdc28 and cdc2 and is an important regulator of the cell cycle (1). CDK9 is a component of the multiprotein complex TAK/P-TEFβ. CDK9 can modulate RNA polymerase II-directed transcription by phosphorylating the C-terminal domain of the largest subunit of RNA polymerase II. CDK9 forms a complex with and is regulated by its regulatory subunit cyclin T or cyclin K. CDK9 also interacts with the HIV-1 Tat protein, which suggests a possible involvement of this protein in AIDS (2).

ADP-Glo™ Kinase Assay is a luminescent kinase assay that measures ADP formed from a kinase reaction; ADP is converted into ATP, which is a substrate in a reaction catalyzed by Ultra-Glo™ Luciferase that produces light. The luminescent signal positively correlates with ADP amount and kinase activity. The assay is well suited for measuring the effects chemical compounds have on the activity of a broad range of purified kinases, making it ideal for both primary screening as well as kinase selectivity profiling. The ADP-Glo™ Kinase Assay can be used to monitor the activity of virtually any ADP-generating enzyme (e.g., kinase or ATPase) using up to 1mM ATP.

Kinase Enzyme System contains:

  • Kinase: CDK9/CyclinK, 10μg (Human, recombinant full-length). MW: ~68kDa (CDK9) and ~67kDa (CyclinK).
  • Substrate: PDKtide ([protein fragment, 39 aa]); residues 1–14 are derived from AKT1 (307–320), and residues 16–39 are derived from PKN2/PRK2 (961–984).
  • Other: Reaction Buffer, DTT.

CDK9/CyclinK NCBI Database Entry.

Human Kinase Enzyme Systems and Applications.

Features - Benefits

  • Profile More Compounds In-House: ADP-Glo™ Kinase Assay + Kinase Enzyme System is optimized so that you are up and running in no time.
  • Complete Systems: The Kinase Enzyme Systems include a recombinant kinase enzyme, a substrate appropriate for the enzyme, a reaction buffer, DTT and supplemental reagents as needed.
  • Obtain Reliable Results: The broad dynamic range, the ease of use and better sensitivity obtained with ADP-Glo™ Kinase Assay result in less ambiguous data.

Notes

Kinase Enzyme System manufactured by SignalChem.
Bulk quantities available upon request.

References

  1. Yang, Z. et al. (2001) The 7SK small nuclear RNA inhibits the CDK9/cyclin T1 kinase to control transcription. Nature 414, 317–22. 
  2. Bullrich, F. et al. (1995) Chromosomal mapping of members of the cdc2 family of protein kinases, cdk3, cdk6, PISSLRE, and PITALRE, and a cdk inhibitor, p27-Kip1, to regions involved in human cancer. Cancer Res. 55, 1199–205. 

Specifications

Storage Conditions

Upon receipt, centrifuge the kinase and dispense it into smaller quantities. Store the kinase at –70°C and the rest of the components at –20°C.

For product intended use please see Patents & Disclaimers tab.

Protocols and manuals

Related citations

Resources

Use Restrictions

V4104, V6283, V4105 For Research Use Only. Not for Use in Diagnostic Procedures.

Patents - Disclaimers

V4105 U.S. Pat. Nos. 7,083,911, 7,452,663 and 7,732,128 and other patents.

V4105 U.S. Pat. No. 7,700,310 and other patents and patents pending.

V4105 U.S. Pat. Nos. 7,741,067, 8,361,739 and 8,603,767 and other patents and patents pending.

V4105 U.S. Pat. Nos. 6,602,677, 7,241,584, 8,030,017 and 8,822,170 and other patents and patents pending.

V4105 U.S. Pat. No. 8,183,007 and other patents and patents pending.

V4105 Licensed from Lonza Nottingham Ltd. under U.S. Pat. Nos. 6,599,711 and 6,911,319 and other pending and issued patents.

Communication is Key 

Whether for R&D, or QC -  get in touch with MyBio for World-leading research products and expertise - for every step of the process.

Next-Day Delivery

We partner with our suppliers to expedite the shipment of your order. Where possible we will offer next day delivery. 

Innovative Approach

Our award winning, innovative service and fresh approach to the industry has a direct and positive impact on you.

Experienced Experts

Our team of highly qualified application scientists can provide you with ongoing support as and when needed.